PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009140597.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 289aa    MW: 31501.5 Da    PI: 8.0468
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009140597.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box28.43.4e-09447441
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                    r C+ + +  ++lfC+ +  +lC +C  ++H        H++v 
  XP_009140597.1  4 RPCDSCRSAAATLFCRADAAFLCGECDGKIHTAnklasrHERVL 47
                    68*****************************5577888888775 PP

2zf-B_box26.11.7e-084791442
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                      C+ +e+ +++  C+ +   lC +C   +H+       H++vp+
  XP_009140597.1 47 LLCQVCEQSPAHVTCKADAAALCVTCDRDIHSAnplsrrHERVPV 91
                    68*****************************66899999*99986 PP

3CCT68.91.3e-23224267144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae RpR+KGrF+k++
  XP_009140597.1 224 REARVLRYREKRKNRKFEKTIRYASRKAYAEVRPRIKGRFAKRT 267
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.8E-15148IPR000315B-box-type zinc finger
PROSITE profilePS5011910.424148IPR000315B-box-type zinc finger
CDDcd000211.50E-8448No hitNo description
PfamPF006433.6E-7446IPR000315B-box-type zinc finger
PROSITE profilePS5011911.1634491IPR000315B-box-type zinc finger
PfamPF006439.7E-74791IPR000315B-box-type zinc finger
CDDcd000213.23E-84891No hitNo description
SMARTSM003361.6E-104991IPR000315B-box-type zinc finger
PfamPF062032.0E-17224266IPR010402CCT domain
PROSITE profilePS5101716.618224266IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010161Biological Processred light signaling pathway
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MASRPCDSCR SAAATLFCRA DAAFLCGECD GKIHTANKLA SRHERVLLCQ VCEQSPAHVT  60
CKADAAALCV TCDRDIHSAN PLSRRHERVP VTPFYDAPSN ADVSMEAASW LLRNPSVKEG  120
GVEIPNLFAD LDYSGVDPKM EASENSSGND GVVPVQTRAL FLSEDYFNFD ISASKTTFPH  180
GFSCINQTVS STSLDVPLVP EGGAVAEMSR TTAAPALQLS PAEREARVLR YREKRKNRKF  240
EKTIRYASRK AYAEVRPRIK GRFAKRTDSR VNDGGEVGVY GGFGVVPSF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.41410.0bud| flower| leaf| root| silique
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0526900.0AF052690.1 Raphanus sativus CONSTANS-like 1 protein (COL1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009140597.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 3
SwissprotQ9SK531e-143COL3_ARATH; Zinc finger protein CONSTANS-LIKE 3
TrEMBLM4ETD10.0M4ETD1_BRARP; Uncharacterized protein
STRINGBra032061.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27602765
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.11e-143CONSTANS-like 3